PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10017882
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family Dof
Protein Properties Length: 267aa    MW: 29369.2 Da    PI: 6.3488
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10017882genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.2e-382382261
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 +++ ++cprCds ntkfCyynny+lsqPr+fCk+CrryWt GG lrnvPvGgg+rk k+s
  Lus10017882 23 HNQPVNCPRCDSVNTKFCYYNNYNLSQPRHFCKSCRRYWTSGGVLRNVPVGGGCRKPKRS 82
                 57899***************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-272381IPR003851Zinc finger, Dof-type
PfamPF027011.8E-322581IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1342781IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102965IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MQDIHSIGGG ARFFAGDRRL RPHNQPVNCP RCDSVNTKFC YYNNYNLSQP RHFCKSCRRY  60
WTSGGVLRNV PVGGGCRKPK RSKPKQNPAS SSAADSTTQP PEDKLNFADS HSSSESSSLT  120
APTTEVISVG NYSISDQNNK LIGNSSLNPS FETASFPVQG GECGMFQFQL REMGSITSLR  180
SWTTKETPSF DTPLSQGQSK DEEEWRMQGM IDPTDQDEYL SVLQSGRSGG FGPLDWNEAG  240
GGGGYFDLPL SAVDHAYWSQ SQWNYD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047913e-49AP004791.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0491D10.
GenBankAP0149623e-49AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322044.21e-57hypothetical protein POPTR_0015s03520g, partial
TrEMBLA9PI211e-58A9PI21_POPTR; Putative uncharacterized protein
STRINGPOPTR_0015s03520.15e-57(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-50OBF binding protein 4